The method of claim 16, wherein the serpina-1 polypeptide and/or albumin polypeptide is measured using an immunological assay.ġ8. A method for identifying onset, progression, or regression of preeclampsia in a pregnant woman, comprising: (a) measuring a level of serpina-1 polypeptide and/or albumin polypeptide in a first sample obtained from the pregnant woman and (b) measuring a level of serpina-1 polypeptide and/or albumin polypeptide in a second sample obtained from the same pregnant woman, wherein the second sample is obtained at a time subsequent to the time the first sample is obtained, wherein an increase in the serpina-1 polypeptide and/or albumin polypeptide level in the second sample relative to the serpina-1 polypeptide and/or albumin polypeptide level in the first sample identifies onset or progression of preeclampsia in the subject and a decrease in the serpina-1 polypeptide and/or albumin polypeptide level in the second sample relative to the serpina-1 polypeptide and/or albumin polypeptide level in the first sample identifies regression of preeclampsia in the subject.ġ7. The method of claim 1, wherein the albumin polypeptide is a fragment of the amino acid sequence set forth as GSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSAL EVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMD DFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGL (SEQ ID NO:10).ġ6. The method of claim 1, wherein the albumin polypeptide comprises the amino acid sequence set forth as DAHKSEVAHRFKDLGEENFKALVLIA (SEQ ID NO:6).ġ5. The method of claim 1, wherein the albumin polypeptide comprises the amino acid sequence set forth as DAHKSEVAHRFKDLGEENFKALVL (SEQ ID NO:5).ġ4. The method of claim 1, wherein the serpina-1 polypeptide comprises the amino acid sequence set forth as EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFS (SEQ ID NO:4).ġ3. The method of claim 1, wherein the serpina-1 polypeptide comprises the amino acid sequence set forth as M oxIEQNTKSPLFM oxGKVVNPTQK (SEQ ID NO:3).ġ2. The method of claim 1, wherein the serpina-1 polypeptide comprises the amino acid sequence set forth as M oxIEQNTKSPLFMGKVVNPTQK (SEQ ID NO:2).ġ0. The method of claim 1, wherein the serpina-1 polypeptide comprises the amino acid sequence set forth as MIEQNTKSPLFMGKVVNPTQK (SEQ ID NO:1).ĩ. The method of claim 1, wherein the serpina-1 polypeptide and/or albumin polypeptide is polymerized serpina-1 polypeptide or polymerized albumin polypeptide respectively.Ĩ. The method of claim 1, wherein the serpina-1 polypeptide and/or albumin polypeptide level is measured by surface-enhanced laser desorption/ionization (SELDI).ħ. The method of claim 1, wherein the serpina-1 polypeptide and/or albumin polypeptide is measured using a protein chip assay.Ħ. The method of claim 1, wherein the immunological assay is an ELISA assay.ĥ. The method of claim 1, wherein the serpina-1 polypeptide and/or albumin polypeptide level is measured using an immunological assay.Ĥ. The method of claim 1, wherein the sample is a urine sample.ģ.
A method of determining that a pregnant woman has preeclampsia or is at increased risk of developing preeclampsia, comprising: (a) measuring a level of serpina-1 polypeptide and/or albumin polypeptide in a sample from the pregnant woman and (b) comparing the level of serpina-1 polypeptide and/or albumin polypeptide in the sample with a reference value, wherein a higher level of serpina-1 polypeptide and/or albumin polypeptide in the sample relative to the reference value indicates that the pregnant woman has preeclampsia or is at increased risk of developing preeclampsia.Ģ. Use of the glycine n-acyl transferase (gnat) for the diagnosis and therapy of inflammatory diseases and sepsisĪssaying apparatus, kit, and method for lipids and associated enzymesĪssay for detection of transferase enzyme activity in drug screeningġ. RADICAL POLYMERIZATION METHOD AND PRODUCTS PREPARED THEREBY METHOD FOR CONVERTING POLYETHYLENE TO BIODEGRADABLE POLYHYDROXYALKANOATE SELECTIVE ENRICHMENT OF NON-METHYLATED NUCLEIC ACIDSĮUKARYOTIC ORGANISMS AND METHODS FOR INCREASING THE AVAILABILITY OF CYTOSOLIC ACETYL-COA, AND FOR PRODUCING 1,3-BUTANEDIOLĬOMPOSITIONS AND METHODS FOR TREATING MYOCARDIAL INFARCTION SELECTIVE OXIDATION OF 5-METHYLCYTOSINE BY TET-FAMILY PROTEINS